CH Peptides
Every formulation is curated with lab-grade ingredients, and we're syncing up the freshest data from our inventory so you see accurate availability as soon as the app loads.
Loading live inventory
Syncing 24 research sprays
Verifying lab supplies
Supabase + Stripe ready
Orders placed before 2 P.M. PST Monday through Friday are shipped out same day!
Looks like you haven't added any products to your cart yet.
Loading...
LL-37, also known by its scientific designation as Cathelicidin antimicrobial peptide LL-37, is derived from the human cathelicidin antimicrobial peptide precursor protein. It has been studied in the context of antimicrobial activity and innate immunity.
LL-37 consists of a linear chain of 37 amino acids with the specific sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH. It does not have specific post-translational modifications like disulfide bridges. LL-37 represents the C-terminal peptide fragment of the human cathelicidin antimicrobial peptide.
LL-37 acts by interacting with microbial membranes, leading to membrane disruption. It has been shown to engage TLR (Toll-like receptor) pathways, indicating a role in immune signaling. Studies have indicated interactions with FPR2 (Formyl Peptide Receptor 2) as an agonist, mediating chemotaxis and inflammatory pathways. LL-37 has reported activity in the MAPK/ERK signaling cascade.
LL-37 is soluble in sterile water at concentrations up to 1 mg/mL. For reconstitution, it is recommended to gently swirl the vial to dissolve. The lyophilized form is stable at room temperature for short durations but should ideally be stored at -20°C. Once reconstituted, it should be stored at 4°C for up to one week or -20°C for extended use.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
LL-37, also known by its scientific designation as Cathelicidin antimicrobial peptide LL-37, is derived from the human cathelicidin antimicrobial peptide precursor protein. It has been studied in the context of antimicrobial activity and innate immunity.
LL-37 consists of a linear chain of 37 amino acids with the specific sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH. It does not have specific post-translational modifications like disulfide bridges. LL-37 represents the C-terminal peptide fragment of the human cathelicidin antimicrobial peptide.
LL-37 acts by interacting with microbial membranes, leading to membrane disruption. It has been shown to engage TLR (Toll-like receptor) pathways, indicating a role in immune signaling. Studies have indicated interactions with FPR2 (Formyl Peptide Receptor 2) as an agonist, mediating chemotaxis and inflammatory pathways. LL-37 has reported activity in the MAPK/ERK signaling cascade.
LL-37 is soluble in sterile water at concentrations up to 1 mg/mL. For reconstitution, it is recommended to gently swirl the vial to dissolve. The lyophilized form is stable at room temperature for short durations but should ideally be stored at -20°C. Once reconstituted, it should be stored at 4°C for up to one week or -20°C for extended use.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Chorionic Gonadotropin; commonly abbreviated as HCG. It is a glycoprotein hormone composed of alpha and beta subunits, predominantly characterized in human pregnancy. No specific research codes or development codes are associated with the basic glycoprotein.
HCG is a heterodimeric protein composed of two non-covalently linked subunits: the alpha subunit (92 amino acids) shared with other hormones like LH, FSH, and TSH, and the beta subunit (145 amino acids) which is unique to HCG. The beta subunit contains distinct segments: H-Trp-Met-Ser-Glu-His-Ile-Thr-Arg-Tyr-Leu-... and features specific disulfide bridges essential for activity and stability.
HCG acts as an agonist to the luteinizing hormone/chorionic gonadotropin receptor (LHCG receptor). Binding of HCG to its receptor activates pathways such as the cAMP/PKA signaling cascade, promoting steroidogenesis. EC50 values are variable based on assay and cellular system but are indicative of potent agonist activity.
HCG is soluble in sterile water at concentrations of 1mg/mL for research applications. Upon reconstitution, the solution must be stored at 2-8°C and is stable for up to 24 hours. Lyophilized HCG remains stable at -20°C until reconstitution.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Retatrutide is referred to by its research code LY3502970. As of current knowledge, alternative naming conventions in the literature have not been extensively established.
Retatrutide is a peptide compound consisting of 39 amino acids. The exact amino acid sequence is: H-Thr-Lys-Asp-Glu-Leu-Gln-Ala-Ile-Arg-Trp-Leu-Lys-His-Glu-Arg-Asp-His-Gly-Ile-Lys-Lys-Glu-Cys-Leu-Glu-Glu-Val-Leu-Asp-Ser-Leu-Ala-Arg-Ala-Glu-Glu-Arg-OH. Specific modifications include N-terminal acetylation and C-terminal amidation to enhance its activity and stability. It is structurally designed to interact with multiple peptide receptors.
Retatrutide acts as an agonist at multiple receptors, including the GLP-1 receptor (GLP-1R) and the GIP receptor (GIPR), exhibiting multifaceted activity. Its mechanism enhances several intracellular signaling pathways, notably the cAMP/PKA and PI3K/Akt cascades. It demonstrates a unique binding profile, combining activities that influence metabolic pathways associated with glucose and lipid handling.
Retatrutide is notably soluble in sterile water at a concentration of 1mg/mL. For research applications, it is recommended to reconstitute the lyophilized form in an appropriate buffer and store it at -20°C to maintain stability. Once reconstituted, it remains stable for up to 3 weeks if stored under proper conditions.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Retatrutide is referred to by its research code LY3502970. As of current knowledge, alternative naming conventions in the literature have not been extensively established.
Retatrutide is a peptide compound consisting of 39 amino acids. The exact amino acid sequence is: H-Thr-Lys-Asp-Glu-Leu-Gln-Ala-Ile-Arg-Trp-Leu-Lys-His-Glu-Arg-Asp-His-Gly-Ile-Lys-Lys-Glu-Cys-Leu-Glu-Glu-Val-Leu-Asp-Ser-Leu-Ala-Arg-Ala-Glu-Glu-Arg-OH. Specific modifications include N-terminal acetylation and C-terminal amidation to enhance its activity and stability. It is structurally designed to interact with multiple peptide receptors.
Retatrutide acts as an agonist at multiple receptors, including the GLP-1 receptor (GLP-1R) and the GIP receptor (GIPR), exhibiting multifaceted activity. Its mechanism enhances several intracellular signaling pathways, notably the cAMP/PKA and PI3K/Akt cascades. It demonstrates a unique binding profile, combining activities that influence metabolic pathways associated with glucose and lipid handling.
Retatrutide is notably soluble in sterile water at a concentration of 1mg/mL. For research applications, it is recommended to reconstitute the lyophilized form in an appropriate buffer and store it at -20°C to maintain stability. Once reconstituted, it remains stable for up to 3 weeks if stored under proper conditions.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.