CH Peptides
Every formulation is curated with lab-grade ingredients, and we're syncing up the freshest data from our inventory so you see accurate availability as soon as the app loads.
Loading live inventory
Syncing 24 research sprays
Verifying lab supplies
Supabase + Stripe ready
Orders placed before 2 P.M. PST Monday through Friday are shipped out same day!
Premium quality peptides designed for researchers pushing the boundaries of scientific discovery.
Have questions? We'd love to hear from you.
Subscribe to our newsletter and be the first to know about new products, exclusive offers, and wellness tips.
Looks like you haven't added any products to your cart yet.
Loading...
Premium lyophilized peptides for research applications
Chorionic Gonadotropin; commonly abbreviated as HCG. It is a glycoprotein hormone composed of alpha and beta subunits, predominantly characterized in human pregnancy. No specific research codes or development codes are associated with the basic glycoprotein.
HCG is a heterodimeric protein composed of two non-covalently linked subunits: the alpha subunit (92 amino acids) shared with other hormones like LH, FSH, and TSH, and the beta subunit (145 amino acids) which is unique to HCG. The beta subunit contains distinct segments: H-Trp-Met-Ser-Glu-His-Ile-Thr-Arg-Tyr-Leu-... and features specific disulfide bridges essential for activity and stability.
HCG acts as an agonist to the luteinizing hormone/chorionic gonadotropin receptor (LHCG receptor). Binding of HCG to its receptor activates pathways such as the cAMP/PKA signaling cascade, promoting steroidogenesis. EC50 values are variable based on assay and cellular system but are indicative of potent agonist activity.
HCG is soluble in sterile water at concentrations of 1mg/mL for research applications. Upon reconstitution, the solution must be stored at 2-8°C and is stable for up to 24 hours. Lyophilized HCG remains stable at -20°C until reconstitution.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Retatrutide is referred to by its research code LY3502970. As of current knowledge, alternative naming conventions in the literature have not been extensively established.
Retatrutide is a peptide compound consisting of 39 amino acids. The exact amino acid sequence is: H-Thr-Lys-Asp-Glu-Leu-Gln-Ala-Ile-Arg-Trp-Leu-Lys-His-Glu-Arg-Asp-His-Gly-Ile-Lys-Lys-Glu-Cys-Leu-Glu-Glu-Val-Leu-Asp-Ser-Leu-Ala-Arg-Ala-Glu-Glu-Arg-OH. Specific modifications include N-terminal acetylation and C-terminal amidation to enhance its activity and stability. It is structurally designed to interact with multiple peptide receptors.
Retatrutide acts as an agonist at multiple receptors, including the GLP-1 receptor (GLP-1R) and the GIP receptor (GIPR), exhibiting multifaceted activity. Its mechanism enhances several intracellular signaling pathways, notably the cAMP/PKA and PI3K/Akt cascades. It demonstrates a unique binding profile, combining activities that influence metabolic pathways associated with glucose and lipid handling.
Retatrutide is notably soluble in sterile water at a concentration of 1mg/mL. For research applications, it is recommended to reconstitute the lyophilized form in an appropriate buffer and store it at -20°C to maintain stability. Once reconstituted, it remains stable for up to 3 weeks if stored under proper conditions.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Retatrutide is referred to by its research code LY3502970. As of current knowledge, alternative naming conventions in the literature have not been extensively established.
Retatrutide is a peptide compound consisting of 39 amino acids. The exact amino acid sequence is: H-Thr-Lys-Asp-Glu-Leu-Gln-Ala-Ile-Arg-Trp-Leu-Lys-His-Glu-Arg-Asp-His-Gly-Ile-Lys-Lys-Glu-Cys-Leu-Glu-Glu-Val-Leu-Asp-Ser-Leu-Ala-Arg-Ala-Glu-Glu-Arg-OH. Specific modifications include N-terminal acetylation and C-terminal amidation to enhance its activity and stability. It is structurally designed to interact with multiple peptide receptors.
Retatrutide acts as an agonist at multiple receptors, including the GLP-1 receptor (GLP-1R) and the GIP receptor (GIPR), exhibiting multifaceted activity. Its mechanism enhances several intracellular signaling pathways, notably the cAMP/PKA and PI3K/Akt cascades. It demonstrates a unique binding profile, combining activities that influence metabolic pathways associated with glucose and lipid handling.
Retatrutide is notably soluble in sterile water at a concentration of 1mg/mL. For research applications, it is recommended to reconstitute the lyophilized form in an appropriate buffer and store it at -20°C to maintain stability. Once reconstituted, it remains stable for up to 3 weeks if stored under proper conditions.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
LL-37, also known by its scientific designation as Cathelicidin antimicrobial peptide LL-37, is derived from the human cathelicidin antimicrobial peptide precursor protein. It has been studied in the context of antimicrobial activity and innate immunity.
LL-37 consists of a linear chain of 37 amino acids with the specific sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH. It does not have specific post-translational modifications like disulfide bridges. LL-37 represents the C-terminal peptide fragment of the human cathelicidin antimicrobial peptide.
LL-37 acts by interacting with microbial membranes, leading to membrane disruption. It has been shown to engage TLR (Toll-like receptor) pathways, indicating a role in immune signaling. Studies have indicated interactions with FPR2 (Formyl Peptide Receptor 2) as an agonist, mediating chemotaxis and inflammatory pathways. LL-37 has reported activity in the MAPK/ERK signaling cascade.
LL-37 is soluble in sterile water at concentrations up to 1 mg/mL. For reconstitution, it is recommended to gently swirl the vial to dissolve. The lyophilized form is stable at room temperature for short durations but should ideally be stored at -20°C. Once reconstituted, it should be stored at 4°C for up to one week or -20°C for extended use.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Scientific Overview:
Cartalax is a synthetic peptide compound classified within a group of bioactive peptides that have been synthesized for detailed molecular biology studies. Its discovery lies in the broader context of peptide research aimed at elucidating complex biochemical pathways and mechanisms.
Cartalax consists of a specific peptide sequence featuring crucial amino acid residues that are instrumental in its interaction with various biomolecular targets. The structure may include post-translational modifications such as acetylation or amidation, which could influence the compound's stability and affinity within research settings. Such structural characteristics are pivotal for understanding receptor binding and signal transduction processes within its research applications.
The synthesis of Cartalax was first accomplished in the context of expanding the repertoire of peptides available for the study of protein interactions and enzymatic pathways. This compound has been investigated in relation to its binding properties and potential receptor targets, shedding light on its specificity and capacity to mimic or inhibit natural ligands. In vitro studies and cellular models have included its use, focusing on cellular responses and regulatory mechanisms instigated by peptide interactions.
Cartalax has been compared to other peptide analogs within its class, providing insights into its relative efficacy and affinities. This comparative analysis contributes to a broader understanding of peptide activity and potential cross-reactivity in research applications, further situating Cartalax in studies of signal modulation and receptor-ligand dynamics.
Cartalax exhibits specific solubility characteristics predominantly in aqueous media and can also be dissolved in organic solvents such as DMSO, depending on experimental requirements. Its stability is affected by environmental factors, and thus it should be handled under controlled conditions to preserve its integrity. For optimal research application, best practices in handling should be observed to mitigate degradation.
The analytical verification of Cartalax is conducted using robust techniques such as high-performance liquid chromatography (HPLC) and mass spectrometry (MS) to ensure the reliability of data in research settings. These methods provide confirmation of molecular identity and concentration.
This product is intended strictly for laboratory research purposes. Not for human or veterinary use. Not intended for diagnosis, treatment, cure, or prevention of any disease. Not for ingestion, injection, or any use in or on living organisms. Handle using appropriate laboratory safety procedures and personal protective equipment.
ARA-290, also known as pyroglutamate helix B surface peptide (pHBSP), is a derivative of erythropoietin's helix B domain. Research codes or alternative naming conventions have primarily referred to it as ARA-290 or pHBSP without additional designations.
The peptide sequence for ARA-290 is Ac-SLTTLLRALGAWGEHPGK-F-NH2, comprising 11 amino acids with specific N-terminal acetylation and C-terminal amidation. This sequence mimics the helix B region of erythropoietin, which is pivotal for its biological activity.
ARA-290 targets the innate repair receptor (IRR), a heteromeric receptor complex formed by the erythropoietin receptor (EPOR) and β-common receptor (βcR). It functions as an agonist, promoting anti-inflammatory and tissue protective pathways. Key signaling pathways include PI3K/Akt and MAPK/ERK, resulting in cytoprotective and regenerative effects. The EC50 or IC50 values specific to receptor interactions have yet to be extensively characterized in literature.
ARA-290 is soluble in sterile water at concentrations of 1 mg/mL. It is recommended to reconstitute the peptide in an appropriate solvent prior to experimental protocols. Lyophilized ARA-290 is stable for up to 24 months at -20°C, whereas reconstituted solutions should be stored at -80°C and used within a month to ensure biological activity.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
The Vasoactive Intestinal Peptide is commonly referred to by its acronym VIP and is a member of the glucagon/secretin family of peptides. It does not have widely known research or development codes but is often categorized under peptides in pharmacological literature.
The exact sequence of VIP is H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2, consisting of 28 amino acids. The peptide is C-terminally amidated, which is crucial for its bioactivity. VIP does not derive from a parent protein but rather is synthesized as a prohormone before being cleaved into its active form.
VIP primarily binds to VPAC1 and VPAC2 receptors, functioning as an agonist. These receptors are coupled to the adenylate cyclase signaling pathway, predominantly increasing cAMP levels, which subsequently activate protein kinase A (PKA). Studies have shown VIP also interacts with pathways involving MAPK/ERK and the PI3K/Akt signaling cascades. Specific EC50 values are strain and preparation-dependent but are typically observed in the nanomolar range for receptor activation.
VIP is soluble in sterile water or 0.1% acetic acid at concentrations up to 1 mg/mL. Stability data demonstrates that the lyophilized form is stable for several months when stored at -20°C to -80°C. Upon reconstitution, it is generally stable for 1-2 weeks at 4°C.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Convenient topical delivery for select research compounds
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It is also referred to by the research code TP-7 and is related to the parent compound Tuftsin, a natural peptide factor.
The amino acid sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro comprises seven residues. Selank is a derivative of the immunomodulatory peptide tuftsin, consisting of the natural tuftsin fragment with a tail to enhance stability and receptor interaction. It lacks modifications such as N-terminal or C-terminal acetylation or amidation.
Selank primarily interacts with neuromodulatory neurotransmitter systems, including serotonin and dopamine systems. It acts as an agonist in these pathways, often impacting the expression of neurotrophic factors. The modulation of cAMP signaling pathways and MAO-A enzyme inhibition are two studied mechanisms, though no specific receptor binding is well-documented.
Selank is soluble in sterile water at 2mg/mL.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Oxytocin Acetate, also known by research codes such as OT-635, is derived from the parent compound oxytocin. It is a neuropeptide hormone used in various research studies focusing on its broad physiological effects.
The peptide sequence of Oxytocin Acetate is Cysteine-Tyrosine-Isoleucine-Glutamine-Asparagine-Cysteine-Proline-Leucine-Glycine-NH2. It consists of 9 amino acids with a disulfide bond between the two cysteine residues, contributing to its cyclic structure. The C-terminal glycine is amidated.
Oxytocin primarily acts as an agonist at the oxytocin receptor (OXTR), a G-protein-coupled receptor that triggers the phosphatidylinositol-calcium second messenger system. It has also been observed to engage with vasopressin receptors, albeit at lower affinity. Studies have outlined its involvement in the modulation of MAPK/ERK and PI3K/Akt pathways, which align with its roles in social and reproductive behaviors.
Oxytocin Acetate is soluble in sterile distilled water at a concentration of 1 mg/mL. It is recommended to handle this compound under sterile conditions to ensure integrity.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Semax is scientifically named as Met-Glu-His-Phe-Pro-Gly-Pro. It is a synthetic heptapeptide derived from the N-terminal fragment of adrenocorticotropic hormone (ACTH). It is commonly referred to as ACTH(4-10) in research literature. There are no specific research or development codes publicly associated with this compound.
The peptide sequence for Semax is Met-Glu-His-Phe-Pro-Gly-Pro, consisting of 7 amino acids. Notably, Semax is modified by the addition of a C-terminal Pro-Gly-Pro sequence which is not present in native ACTH. It does not contain disulfide bridges or other typical peptide modifications like acetylation or amidation.
Semax primarily targets melanocortin receptors, specifically acting as an agonist at the MC4 receptor. It is thought to influence signaling pathways such as cAMP/PKA due to its derivation from ACTH. Semax's selectivity towards MC4 is noted to be higher compared to other melanocortin receptors.
Semax is soluble in sterile water at 1 mg/mL. For research use, it is recommended that this compound be stored in lyophilized form at -20°C for long-term stability.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Nicotinamide adenine dinucleotide in its reduced form does not have specific other designations or distinguished development codes. It is derived from core compounds encompassing nicotinamide, ribose, and adenine dinucleotide structures. Common scientific references use 'NAD+' interchangeably with these components.
NAD+ itself is not an amino acid peptide, therefore it does not have an amino acid sequence. It is a dinucleotide derived from two nucleosides (adenine and nicotinamide) linked through their phosphate groups. No specific structural modifications such as acetylation or amidation apply beyond standard biochemical redox processes where NAD+ undergoes conversion to NADH and vice versa.
The activity of NAD+ prominently involves its role as a cofactor. It is integrally involved in enzymatic reactions such as dehydrogenase activity where it acts as an electron donor/acceptor. It plays a role in pathways like the poly(ADP-ribose) polymerase (PARP) family, SIRT1-7 in the sirtuin class (acting as a co-substrate to deacetylases), and key roles in cellular signaling pathways including calcium signaling, energy production through oxidative phosphorylation, and the tricarboxylic acid cycle.
Soluble in aqueous solutions, generally recommended for reconstitution in distilled water at concentrations appropriate to experimental requirements.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Convenient oral delivery for research compounds
Methylene blue, also scientifically known as tetramethylthionine chloride, is a heterocyclic aromatic chemical compound. It is frequently referred to in research by its chemical name and has been used historically in various applications, although specific research codes have not been consistently applied to this compound.
Methylene blue does not consist of an amino acid sequence as it is a phenothiazine derivative. It has a tricyclic phenothiazine structure, featuring a central sulfur and nitrogen atom with methyl substitutions that influence its redox properties. The compound is not derived from a larger protein fragment, but its planar aromatic structure is crucial for its electron transfer capability.
Methylene blue primarily functions by inhibiting the enzyme guanylate cyclase, thus impacting the NO-cGMP pathway. This interference can modulate vascular tone and neurotransmitter release. It has also been noted to act as a redox agent, accepting and donating electrons through alteration in its oxidation states. EC50 values vary depending on the cellular context, but it can modulate several cellular processes via its electron transfer roles.
Methylene blue is highly soluble in water, particularly at concentrations such as 1mg/mL, making it conducive for aqueous applications. Reconstitution is recommended in sterile water or appropriate buffer solutions. Stability data suggest that it remains stable in lyophilized form and must be handled under light-limiting conditions due to its photolabile nature.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
The full chemical name for Tesofensine is (3R)-1,3,4,5-tetrahydro-3-[2-(dimethylamino)ethyl]-2-benzofuran-5-ol. It is referred to as NS-2330 in early development stages, and its parent compound is derived from sibutramine, though it is not a direct fragment or analog. Alternative naming in literature includes the designation Tesofensine without additional numeric codes.
Tesofensine is not a peptide and thus lacks an amino acid sequence; it is a small organic molecule without recognizable peptide modifications. However, its molecular conformation is non-linear, with a distinct benzofuran moiety that contributes to its biological activity.
Tesofensine is a potent inhibitor of presynaptic reuptake of norepinephrine, dopamine, and serotonin. It has been shown to act as an indirect agonist at these monoaminergic pathways. Studies indicate that it increases extracellular concentrations of these neurotransmitters, exerting its pharmacological effects through modulation of monoaminergic signaling cascades. The pharmacological profile includes a higher binding affinity for the serotonin transporter (SERT) compared to norepinephrine (NET) and dopamine (DAT) transporters. Precise EC50/IC50 values can vary across studies.
Tesofensine is soluble in DMSO at concentrations exceeding 10mg/mL and requires careful control of solubility conditions during reconstitution. For research purposes, it should be stored as a lyophilized powder in a desiccated environment to ensure stability. Reconstituted solutions are stable for short periods at low temperatures.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
The full chemical name for Tesofensine is (3R)-1,3,4,5-tetrahydro-3-[2-(dimethylamino)ethyl]-2-benzofuran-5-ol. It is referred to as NS-2330 in early development stages, and its parent compound is derived from sibutramine, though it is not a direct fragment or analog. Alternative naming in literature includes the designation Tesofensine without additional numeric codes.
Tesofensine is not a peptide and thus lacks an amino acid sequence; it is a small organic molecule without recognizable peptide modifications. However, its molecular conformation is non-linear, with a distinct benzofuran moiety that contributes to its biological activity.
Tesofensine is a potent inhibitor of presynaptic reuptake of norepinephrine, dopamine, and serotonin. It has been shown to act as an indirect agonist at these monoaminergic pathways. Studies indicate that it increases extracellular concentrations of these neurotransmitters, exerting its pharmacological effects through modulation of monoaminergic signaling cascades. The pharmacological profile includes a higher binding affinity for the serotonin transporter (SERT) compared to norepinephrine (NET) and dopamine (DAT) transporters. Precise EC50/IC50 values can vary across studies.
Tesofensine is soluble in DMSO at concentrations exceeding 10mg/mL and requires careful control of solubility conditions during reconstitution. For research purposes, it should be stored as a lyophilized powder in a desiccated environment to ensure stability. Reconstituted solutions are stable for short periods at low temperatures.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
BPC-157, an acronym for Body Protection Compound-157, is a pentadecapeptide with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. While it is often referred to as its BPC code name in scientific literature, it does not have an associated pharmaceutical development code or alternative naming conventions beyond BPC-157.
BPC-157 consists of 15 amino acids, specifically Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. It does not derive from a larger parent protein nor does it possess any specific post-translational modifications such as N-terminal acetylation or C-terminal amidation. Its endogenous-like sequence contributes to its stability and resistance to protease degradation.
BPC-157 has been studied for its potential interaction with growth hormone receptor pathways, although specific receptor targets are yet to be fully elucidated. Current studies suggest involvement in angiogenesis and NO pathway modulation. Detailed signaling pathways such as MAPK/ERK, PI3K/Akt, and other angiogenic-related cascades have been indicated, though precise EC50/IC50 values are not well-documented.
BPC-157 is soluble in sterile water and typically recommended at concentrations of 1mg/mL for research applications. It remains stable in lyophilized form at room temperature for extended periods, whereas reconstituted solutions are stable when refrigerated (< 8°C) for short-term use.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
BAM15 is identified as a mitochondrial uncoupler with the full chemical name N5,N6-bis(benzyloxycarbonyl)-D-antenyl glycinamide. It has been referenced under the research code BAM-15 in scientific studies. It does not derive from a parent compound, as it is synthetically designed for mitochondrial research applications.
BAM15 does not possess an amino acid sequence as it is not a peptide-based compound. As a small molecule, it lacks peptide chain modifications such as N-terminal acetylation or disulfide bonds typically mentioned in peptide-based research.
BAM15 acts as a protonophore which uncouples oxidative phosphorylation by facilitating the transport of protons across the mitochondrial inner membrane, disrupting the proton gradient. This uncoupling action is not mediated through specific receptor binding but rather through its physicochemical properties. It disrupts membrane potential, thereby affecting ATP synthesis without involving typical cellular signaling cascades like cAMP/PKA, MAPK/ERK, or PI3K/Akt.
BAM15 demonstrates solubility in DMSO and ethanol at a recommended concentration for experimental use. For research purposes, it should be dissolved at 50 mg/mL concentrations, with stability maintained when stored as a lyophilized powder. Once reconstituted, solutions should be used promptly or stored at -20°C to preserve activity.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
BAM15 is known scientifically as N-hydroxy-N',N'-dimethyl-N-(5-(4-((2-phenylthiazol-4-yl)methyl)piperazin-1-yl)pentyl)-3-phenylpropionamide. In scientific literature, it may be referred to without a specific research code, as it is not derived from protein sequences. It was first synthesized by researchers in academia studying mitochondrial uncouplers.
BAM15 is a small molecule rather than a peptide, and does not have an amino acid sequence. Its structure includes a thiazole ring system and a piperazine moiety, contributing to its activity as a mitochondrial uncoupler. There are no residues or peptide fragments associated with it, as it is not peptide-based.
BAM15 functions as a mitochondrial uncoupler, disrupting the proton gradient across the mitochondrial inner membrane, leading to increased energy expenditure. This mechanism does not involve traditional receptor binding such as GPCRs, hence does not target conventional receptors like GLP-1R or β3-AR. Studies have shown that BAM15 can increase cellular respiration and energy expenditure by dissipating the electrochemical gradient, although exact pathways such as cAMP/PKA or MAPK/ERK are not directly engaged.
BAM15 is soluble in DMSO and organic solvents rather than aqueous solutions. It is typically reconstituted in these solvents for research purposes. Stability data indicates that while BAM15 is stable in its lyophilized form, precautions should be taken to store reconstituted solutions at low temperatures to prevent degradation.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Enclomiphene is known by its chemical name (E)-2-[4-(2-Chloro-1,2-diphenylethenyl)phenoxy]-N,N-diethylethanamine. Its developmental research codes include CLOMID (a mixture of enclomiphene and its stereoisomer, zuclomiphene) with no separate specific development code for enclomiphene alone. It is derived from clomiphene, where enclomiphene is one of the stereoisomers.
Enclomiphene is not a peptide but a small molecule, thus no amino acid sequence is applicable. The key structural feature involves its trans stereochemistry around the central double bond, affecting its configuration compared to zuclomiphene.
Enclomiphene acts primarily as an estrogen receptor antagonist, particularly at the ERα and ERβ receptors. It functions by obstructing the estrogen-mediated negative feedback on the hypothalamus, resulting in increased gonadotropin release. The signaling cascades involved primarily include the modulation of estrogen receptor signaling pathways.
Enclomiphene is soluble in organic solvents such as ethanol and DMSO. Recommended storage involves maintaining the compound in a dry, cool environment to preserve stability. Lyophilized form is highly stable and should be reconstituted in organic solvent for research use.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
BPC-157, an acronym for Body Protection Compound-157, is a pentadecapeptide with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. While it is often referred to as its BPC code name in scientific literature, it does not have an associated pharmaceutical development code or alternative naming conventions beyond BPC-157.
BPC-157 consists of 15 amino acids, specifically Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. It does not derive from a larger parent protein nor does it possess any specific post-translational modifications such as N-terminal acetylation or C-terminal amidation. Its endogenous-like sequence contributes to its stability and resistance to protease degradation.
BPC-157 has been studied for its potential interaction with growth hormone receptor pathways, although specific receptor targets are yet to be fully elucidated. Current studies suggest involvement in angiogenesis and NO pathway modulation. Detailed signaling pathways such as MAPK/ERK, PI3K/Akt, and other angiogenic-related cascades have been indicated, though precise EC50/IC50 values are not well-documented.
BPC-157 is soluble in sterile water and typically recommended at concentrations of 1mg/mL for research applications. It remains stable in lyophilized form at room temperature for extended periods, whereas reconstituted solutions are stable when refrigerated (< 8°C) for short-term use.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Discover our latest premium peptide formulations
Chorionic Gonadotropin; commonly abbreviated as HCG. It is a glycoprotein hormone composed of alpha and beta subunits, predominantly characterized in human pregnancy. No specific research codes or development codes are associated with the basic glycoprotein.
HCG is a heterodimeric protein composed of two non-covalently linked subunits: the alpha subunit (92 amino acids) shared with other hormones like LH, FSH, and TSH, and the beta subunit (145 amino acids) which is unique to HCG. The beta subunit contains distinct segments: H-Trp-Met-Ser-Glu-His-Ile-Thr-Arg-Tyr-Leu-... and features specific disulfide bridges essential for activity and stability.
HCG acts as an agonist to the luteinizing hormone/chorionic gonadotropin receptor (LHCG receptor). Binding of HCG to its receptor activates pathways such as the cAMP/PKA signaling cascade, promoting steroidogenesis. EC50 values are variable based on assay and cellular system but are indicative of potent agonist activity.
HCG is soluble in sterile water at concentrations of 1mg/mL for research applications. Upon reconstitution, the solution must be stored at 2-8°C and is stable for up to 24 hours. Lyophilized HCG remains stable at -20°C until reconstitution.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Methylene blue, also scientifically known as tetramethylthionine chloride, is a heterocyclic aromatic chemical compound. It is frequently referred to in research by its chemical name and has been used historically in various applications, although specific research codes have not been consistently applied to this compound.
Methylene blue does not consist of an amino acid sequence as it is a phenothiazine derivative. It has a tricyclic phenothiazine structure, featuring a central sulfur and nitrogen atom with methyl substitutions that influence its redox properties. The compound is not derived from a larger protein fragment, but its planar aromatic structure is crucial for its electron transfer capability.
Methylene blue primarily functions by inhibiting the enzyme guanylate cyclase, thus impacting the NO-cGMP pathway. This interference can modulate vascular tone and neurotransmitter release. It has also been noted to act as a redox agent, accepting and donating electrons through alteration in its oxidation states. EC50 values vary depending on the cellular context, but it can modulate several cellular processes via its electron transfer roles.
Methylene blue is highly soluble in water, particularly at concentrations such as 1mg/mL, making it conducive for aqueous applications. Reconstitution is recommended in sterile water or appropriate buffer solutions. Stability data suggest that it remains stable in lyophilized form and must be handled under light-limiting conditions due to its photolabile nature.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
The full chemical name for Tesofensine is (3R)-1,3,4,5-tetrahydro-3-[2-(dimethylamino)ethyl]-2-benzofuran-5-ol. It is referred to as NS-2330 in early development stages, and its parent compound is derived from sibutramine, though it is not a direct fragment or analog. Alternative naming in literature includes the designation Tesofensine without additional numeric codes.
Tesofensine is not a peptide and thus lacks an amino acid sequence; it is a small organic molecule without recognizable peptide modifications. However, its molecular conformation is non-linear, with a distinct benzofuran moiety that contributes to its biological activity.
Tesofensine is a potent inhibitor of presynaptic reuptake of norepinephrine, dopamine, and serotonin. It has been shown to act as an indirect agonist at these monoaminergic pathways. Studies indicate that it increases extracellular concentrations of these neurotransmitters, exerting its pharmacological effects through modulation of monoaminergic signaling cascades. The pharmacological profile includes a higher binding affinity for the serotonin transporter (SERT) compared to norepinephrine (NET) and dopamine (DAT) transporters. Precise EC50/IC50 values can vary across studies.
Tesofensine is soluble in DMSO at concentrations exceeding 10mg/mL and requires careful control of solubility conditions during reconstitution. For research purposes, it should be stored as a lyophilized powder in a desiccated environment to ensure stability. Reconstituted solutions are stable for short periods at low temperatures.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Our best-selling products loved by customers
Chorionic Gonadotropin; commonly abbreviated as HCG. It is a glycoprotein hormone composed of alpha and beta subunits, predominantly characterized in human pregnancy. No specific research codes or development codes are associated with the basic glycoprotein.
HCG is a heterodimeric protein composed of two non-covalently linked subunits: the alpha subunit (92 amino acids) shared with other hormones like LH, FSH, and TSH, and the beta subunit (145 amino acids) which is unique to HCG. The beta subunit contains distinct segments: H-Trp-Met-Ser-Glu-His-Ile-Thr-Arg-Tyr-Leu-... and features specific disulfide bridges essential for activity and stability.
HCG acts as an agonist to the luteinizing hormone/chorionic gonadotropin receptor (LHCG receptor). Binding of HCG to its receptor activates pathways such as the cAMP/PKA signaling cascade, promoting steroidogenesis. EC50 values are variable based on assay and cellular system but are indicative of potent agonist activity.
HCG is soluble in sterile water at concentrations of 1mg/mL for research applications. Upon reconstitution, the solution must be stored at 2-8°C and is stable for up to 24 hours. Lyophilized HCG remains stable at -20°C until reconstitution.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
Methylene blue, also scientifically known as tetramethylthionine chloride, is a heterocyclic aromatic chemical compound. It is frequently referred to in research by its chemical name and has been used historically in various applications, although specific research codes have not been consistently applied to this compound.
Methylene blue does not consist of an amino acid sequence as it is a phenothiazine derivative. It has a tricyclic phenothiazine structure, featuring a central sulfur and nitrogen atom with methyl substitutions that influence its redox properties. The compound is not derived from a larger protein fragment, but its planar aromatic structure is crucial for its electron transfer capability.
Methylene blue primarily functions by inhibiting the enzyme guanylate cyclase, thus impacting the NO-cGMP pathway. This interference can modulate vascular tone and neurotransmitter release. It has also been noted to act as a redox agent, accepting and donating electrons through alteration in its oxidation states. EC50 values vary depending on the cellular context, but it can modulate several cellular processes via its electron transfer roles.
Methylene blue is highly soluble in water, particularly at concentrations such as 1mg/mL, making it conducive for aqueous applications. Reconstitution is recommended in sterile water or appropriate buffer solutions. Stability data suggest that it remains stable in lyophilized form and must be handled under light-limiting conditions due to its photolabile nature.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.
LL-37, also known by its scientific designation as Cathelicidin antimicrobial peptide LL-37, is derived from the human cathelicidin antimicrobial peptide precursor protein. It has been studied in the context of antimicrobial activity and innate immunity.
LL-37 consists of a linear chain of 37 amino acids with the specific sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-COOH. It does not have specific post-translational modifications like disulfide bridges. LL-37 represents the C-terminal peptide fragment of the human cathelicidin antimicrobial peptide.
LL-37 acts by interacting with microbial membranes, leading to membrane disruption. It has been shown to engage TLR (Toll-like receptor) pathways, indicating a role in immune signaling. Studies have indicated interactions with FPR2 (Formyl Peptide Receptor 2) as an agonist, mediating chemotaxis and inflammatory pathways. LL-37 has reported activity in the MAPK/ERK signaling cascade.
LL-37 is soluble in sterile water at concentrations up to 1 mg/mL. For reconstitution, it is recommended to gently swirl the vial to dissolve. The lyophilized form is stable at room temperature for short durations but should ideally be stored at -20°C. Once reconstituted, it should be stored at 4°C for up to one week or -20°C for extended use.
For laboratory research use only. Not for human or veterinary use. Not intended for diagnostic, therapeutic, or preventive applications.